PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10020766m
Common NameCARUB_v10020766mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 280aa    MW: 31861.1 Da    PI: 4.8759
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10020766mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.81.4e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l + +   G  +W+++++  g+ R++k+c++rw +yl
  Carubv10020766m 14 KGPWTAEEDRKLMNFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.26.1e-1673111747
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       E++  +d++ qlG++ W++Ia++++ gRt++++k++w+++
  Carubv10020766m  73 YEEKMVIDLHSQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      599*************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-20562IPR009057Homeodomain-like
PROSITE profilePS5129413.853961IPR017930Myb domain
SuperFamilySSF466891.54E-2611108IPR009057Homeodomain-like
SMARTSM007172.3E-111363IPR001005SANT/Myb domain
PfamPF002491.5E-131461IPR001005SANT/Myb domain
CDDcd001678.08E-81661No hitNo description
PROSITE profilePS5129425.04162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2463116IPR009057Homeodomain-like
SMARTSM007171.6E-1366114IPR001005SANT/Myb domain
PfamPF002491.5E-1373111IPR001005SANT/Myb domain
CDDcd001672.20E-1074112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDRKLMNFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDYEEKMVID LHSQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPLTHKPLS IVEQEDEEPV KKLQKVQVPL QEPVKKTLEE PSNTKNMLTL EEPQDDDQFM  180
AMNLDYGLED VPLMDPESLE LICSNSTMSS STSTSSNSSN DSSFLKDLQF PADFEWSDYG  240
NSSNNEGVDN IIENNMMSLW DVDDFSSWDL LLSSTFGLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195650.0AY519565.1 Arabidopsis thaliana MYB transcription factor (At1g66230) mRNA, complete cds.
GenBankBT0289040.0BT028904.1 Arabidopsis thaliana unknown protein (At1g66230) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302662.10.0hypothetical protein CARUB_v10020766mg
TrEMBLR0IBN60.0R0IBN6_9BRAS; Uncharacterized protein
STRINGscaffold_201335.11e-161(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.11e-135myb domain protein 20